1. Welcome to the new MacRumors forums. See our announcement and read our FAQ

What the Hell is this?

Discussion in 'Distributed Computing' started by jethroted, May 5, 2003.

  1. macrumors 6502a

    jethroted

    #1
    I just got this crazy WU

    SH3ligGH2/pdb1qwe.1.spa

    It's not listen on the folding site. So I have no idea what it is, or how many credits it's worth. Does anyone know what the story with this thing is?
     
  2. Moderator emeritus

    Rower_CPU

    #2
    I have no idea what that's all about.

    Could you post your whole F@Hlog so we can see more info?
     
  3. macrumors 6502a

    jethroted

    #3
    Here is the log

    Processing work unit
    [19:46:29] Core required: FahCore_ca.exe
    [19:46:29] Core not found.
    [19:46:29] - Core is not present or corrupted.
    [19:46:29] - Attempting to download new core...
    [19:46:29] + Downloading new core: FahCore_ca.exe
    [19:46:30] + 10240 bytes downloaded
    [19:46:30] + 20480 bytes downloaded
    [19:46:31] + 30720 bytes downloaded
    [19:46:31] + 40960 bytes downloaded
    [19:46:31] + 51200 bytes downloaded
    [19:46:31] + 61440 bytes downloaded
    [19:46:31] + 71680 bytes downloaded
    [19:46:31] + 81920 bytes downloaded
    [19:46:31] + 92160 bytes downloaded
    [19:46:31] + 102400 bytes downloaded
    [19:46:31] + 112640 bytes downloaded
    [19:46:31] + 122880 bytes downloaded
    [19:46:31] + 133120 bytes downloaded
    [19:46:31] + 143360 bytes downloaded
    [19:46:32] + 153600 bytes downloaded
    [19:46:32] + 163840 bytes downloaded
    [19:46:32] + 174080 bytes downloaded
    [19:46:32] + 184320 bytes downloaded
    [19:46:32] + 194560 bytes downloaded
    [19:46:32] + 204800 bytes downloaded
    [19:46:32] + 215040 bytes downloaded
    [19:46:32] + 225280 bytes downloaded
    [19:46:32] + 235520 bytes downloaded
    [19:46:32] + 245760 bytes downloaded
    [19:46:32] + 256000 bytes downloaded
    [19:46:33] + 266240 bytes downloaded
    [19:46:33] + 276480 bytes downloaded
    [19:46:33] + 286720 bytes downloaded
    [19:46:33] + 296960 bytes downloaded
    [19:46:33] + 307200 bytes downloaded
    [19:46:33] + 317440 bytes downloaded
    [19:46:33] + 327680 bytes downloaded
    [19:46:33] + 337920 bytes downloaded
    [19:46:33] + 348160 bytes downloaded
    [19:46:33] + 358400 bytes downloaded
    [19:46:33] + 368640 bytes downloaded
    [19:46:33] + 378880 bytes downloaded
    [19:46:34] + 389120 bytes downloaded
    [19:46:34] + 399360 bytes downloaded
    [19:46:34] + 409600 bytes downloaded
    [19:46:34] + 419840 bytes downloaded
    [19:46:34] + 430080 bytes downloaded
    [19:46:34] + 440320 bytes downloaded
    [19:46:34] + 450560 bytes downloaded
    [19:46:34] + 460800 bytes downloaded
    [19:46:34] + 471040 bytes downloaded
    [19:46:34] + 480026 bytes downloaded
    [19:46:34] Verifying core Core_ca.fah...
    [19:46:34] Signature is VALID
    [19:46:34] Created: Wednesday April 10, 2002 00:01:22 UTC
    [19:46:34] Signed: Monday March 3, 2003 00:18:15 UTC
    [19:46:34]
    [19:46:34] Trying to unzip core FahCore_ca.exe
    [19:46:35] Decompressed FahCore_ca.exe (1466368 bytes) successfully
    [19:46:35] + Core successfully engaged
    [19:46:40]
    [19:46:40] + Processing work unit
    [19:46:40] Core required: FahCore_ca.exe
    [19:46:40] Core found.
    [19:46:40] Working on Unit 05 [May 5 19:46:40]
    [19:46:40] + Working ...
    [19:46:40] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
    [19:46:40]
    [19:46:40] Proj: work/wudata_05
    [19:46:40] Finding work files
    [19:46:40] sizeof(CORE_PACKET_HDR) = 512
    [19:46:40] Checking frame files
    [19:46:40] - Couldn't open work/wudata_05.chk
    [19:46:40] Starting from initial work packet
    [19:46:40]
    [19:46:40] Updating shared core-client information
    [19:46:40] - Writing "work/wudata_05.key": (overwrite)successful.
    [19:46:40] Key file to update shared file: work/wudata_05.key
    [19:46:40] keyfile: 0 68 200 15 2 1 0
    [19:46:40] Protein: SH3ligGH2/pdb1qwe.1.spa
    [19:46:40] - Frames Completed: 0, Remaining: 600
    [19:46:40] - Dynamic steps required: 120000
    [19:46:40]
    [19:46:42] Printed current.prm
    [19:46:42] Writing local files:
    [19:46:42] - Writing "work/wudata_05.key": (overwrite)successful.
    [19:46:42] - Writing "work/wudata_05.xyz": (overwrite)successful.
    [19:46:43] - Writing "work/wudata_05.prm": (overwrite)successful.
    [19:46:43] Starting design engine
    [19:46:43] [SPG] project name: work/wudata_05.
    [19:46:43] [SPG] 1 0
    [19:46:43] [SPG] Unrecognized atom
    [19:46:43] [SPG] Unrecognized atom
    [19:46:43] [SPG] Initializing protein design engine
    [19:46:43] [SPG] seed = 0
    [19:46:43] [SPG] Initialization complete
    [19:46:43] [SPG] Writing current.pdb, chainlength = 68
    [19:46:43] [SPG] Writing current.xyz
    [19:46:43] [SPG] Preprocessing . . .
    [19:46:43] [SPG] 68 positions in protein
    [19:47:29] [SPG] Preprocessing complete
    [19:47:29] Iterations: 0 of 600
    [19:47:30] Finished
    [19:47:30] [SPG] Native chi angles stored
    [19:47:31] [SPG] Rotamers read
    [19:47:31] [SPG] Unrecognized atom
    [19:47:31] [SPG] Unrecognized atom
    [19:47:31] [SPG] Starting genetic algorithm
    [19:48:45] [SPG] seed: 2324246
    [19:48:46] [SPG] Designing protein sequence 1 of 30
    [19:51:44] [SPG] 10.0
    [19:54:39] [SPG] 20.0
    [19:57:13] [SPG] 30.0
    [19:59:39] [SPG] 40.0
    [20:02:00] [SPG] 50.0
    [20:04:14] [SPG] 60.0
    [20:06:29] [SPG] 70.0
    [20:08:48] [SPG] 80.0
    [20:11:05] [SPG] 90.0
    [20:13:19] [SPG] 100.0
    [20:13:19] [SPG] Writing current.xyz
    [20:13:20] [SPG] Sequence 1 completed:
    [20:13:20] ELYSVYPISAPTSNMLPVTSGKLIKLINPSMGPVPLFYLRSDGKPGYGYG . . .
    [20:13:20] Iterations: 20 of 600
    [20:13:21] Finished
    [20:13:22] [SPG] seed: 4648492
    [20:13:22] [SPG] Designing protein sequence 2 of 30
    [20:16:26] [SPG] 10.0
    [20:19:21] [SPG] 20.0
    [20:22:02] [SPG] 30.0
    [20:24:17] [SPG] 40.0
    [20:26:26] [SPG] 50.0
    [20:28:30] [SPG] 60.0
    [20:30:30] [SPG] 70.0
    [20:32:27] [SPG] 80.0
    [20:34:23] [SPG] 90.0
    [20:36:22] [SPG] 100.0
    [20:36:22] [SPG] Writing current.xyz
    [20:36:22] [SPG] Sequence 2 completed:
    [20:36:22] SLYAVYPFPASTSAAVNATAGQLLKPLNPTMGTVLVMYVPTPGTEGYMKG . . .
    [20:36:22] Iterations: 40 of 600
    [20:36:23] Finished
    [20:36:24] [SPG] seed: 6972738
    [20:36:24] [SPG] Designing protein sequence 3 of 30
    [20:39:19] [SPG] 10.0
    [20:42:06] [SPG] 20.0
    [20:44:43] [SPG] 30.0
    [20:47:08] [SPG] 40.0
    [20:49:31] [SPG] 50.0
    [20:52:02] [SPG] 60.0
    [20:54:23] [SPG] 70.0
    [20:56:40] [SPG] 80.0
    [20:59:07] [SPG] 90.0
     
  4. pEZ
    macrumors 6502

    #4
    Yeah, that's kinda creepy. New core?
     
  5. macrumors 604

    MrMacMan

    #5
    Looks liek you got a new beta (maybe alpha) core/protein, good job, tell us how much it gives you and such, how long compared to others...

    Very intresting...
     
  6. Moderator emeritus

    #6
    SPG has been around for a while but only for Windows folders. My progress monitor recognises SPG WUs as well as the other two although I'm not sure how well it handles it since I didn't have it running.
     
  7. macrumors 6502a

    jethroted

    #7
    Which progress monitor is that?
     

Share This Page