Become a MacRumors Supporter for $50/year with no ads, ability to filter front page stories, and private forums.

jethroted

macrumors 6502a
Original poster
Jan 2, 2003
619
0
Cyberspace
I just got this crazy WU

SH3ligGH2/pdb1qwe.1.spa

It's not listen on the folding site. So I have no idea what it is, or how many credits it's worth. Does anyone know what the story with this thing is?
 
Here is the log

Processing work unit
[19:46:29] Core required: FahCore_ca.exe
[19:46:29] Core not found.
[19:46:29] - Core is not present or corrupted.
[19:46:29] - Attempting to download new core...
[19:46:29] + Downloading new core: FahCore_ca.exe
[19:46:30] + 10240 bytes downloaded
[19:46:30] + 20480 bytes downloaded
[19:46:31] + 30720 bytes downloaded
[19:46:31] + 40960 bytes downloaded
[19:46:31] + 51200 bytes downloaded
[19:46:31] + 61440 bytes downloaded
[19:46:31] + 71680 bytes downloaded
[19:46:31] + 81920 bytes downloaded
[19:46:31] + 92160 bytes downloaded
[19:46:31] + 102400 bytes downloaded
[19:46:31] + 112640 bytes downloaded
[19:46:31] + 122880 bytes downloaded
[19:46:31] + 133120 bytes downloaded
[19:46:31] + 143360 bytes downloaded
[19:46:32] + 153600 bytes downloaded
[19:46:32] + 163840 bytes downloaded
[19:46:32] + 174080 bytes downloaded
[19:46:32] + 184320 bytes downloaded
[19:46:32] + 194560 bytes downloaded
[19:46:32] + 204800 bytes downloaded
[19:46:32] + 215040 bytes downloaded
[19:46:32] + 225280 bytes downloaded
[19:46:32] + 235520 bytes downloaded
[19:46:32] + 245760 bytes downloaded
[19:46:32] + 256000 bytes downloaded
[19:46:33] + 266240 bytes downloaded
[19:46:33] + 276480 bytes downloaded
[19:46:33] + 286720 bytes downloaded
[19:46:33] + 296960 bytes downloaded
[19:46:33] + 307200 bytes downloaded
[19:46:33] + 317440 bytes downloaded
[19:46:33] + 327680 bytes downloaded
[19:46:33] + 337920 bytes downloaded
[19:46:33] + 348160 bytes downloaded
[19:46:33] + 358400 bytes downloaded
[19:46:33] + 368640 bytes downloaded
[19:46:33] + 378880 bytes downloaded
[19:46:34] + 389120 bytes downloaded
[19:46:34] + 399360 bytes downloaded
[19:46:34] + 409600 bytes downloaded
[19:46:34] + 419840 bytes downloaded
[19:46:34] + 430080 bytes downloaded
[19:46:34] + 440320 bytes downloaded
[19:46:34] + 450560 bytes downloaded
[19:46:34] + 460800 bytes downloaded
[19:46:34] + 471040 bytes downloaded
[19:46:34] + 480026 bytes downloaded
[19:46:34] Verifying core Core_ca.fah...
[19:46:34] Signature is VALID
[19:46:34] Created: Wednesday April 10, 2002 00:01:22 UTC
[19:46:34] Signed: Monday March 3, 2003 00:18:15 UTC
[19:46:34]
[19:46:34] Trying to unzip core FahCore_ca.exe
[19:46:35] Decompressed FahCore_ca.exe (1466368 bytes) successfully
[19:46:35] + Core successfully engaged
[19:46:40]
[19:46:40] + Processing work unit
[19:46:40] Core required: FahCore_ca.exe
[19:46:40] Core found.
[19:46:40] Working on Unit 05 [May 5 19:46:40]
[19:46:40] + Working ...
[19:46:40] Folding@home Protein Design Core Version 2.06 (Feb 25, 2003)
[19:46:40]
[19:46:40] Proj: work/wudata_05
[19:46:40] Finding work files
[19:46:40] sizeof(CORE_PACKET_HDR) = 512
[19:46:40] Checking frame files
[19:46:40] - Couldn't open work/wudata_05.chk
[19:46:40] Starting from initial work packet
[19:46:40]
[19:46:40] Updating shared core-client information
[19:46:40] - Writing "work/wudata_05.key": (overwrite)successful.
[19:46:40] Key file to update shared file: work/wudata_05.key
[19:46:40] keyfile: 0 68 200 15 2 1 0
[19:46:40] Protein: SH3ligGH2/pdb1qwe.1.spa
[19:46:40] - Frames Completed: 0, Remaining: 600
[19:46:40] - Dynamic steps required: 120000
[19:46:40]
[19:46:42] Printed current.prm
[19:46:42] Writing local files:
[19:46:42] - Writing "work/wudata_05.key": (overwrite)successful.
[19:46:42] - Writing "work/wudata_05.xyz": (overwrite)successful.
[19:46:43] - Writing "work/wudata_05.prm": (overwrite)successful.
[19:46:43] Starting design engine
[19:46:43] [SPG] project name: work/wudata_05.
[19:46:43] [SPG] 1 0
[19:46:43] [SPG] Unrecognized atom
[19:46:43] [SPG] Unrecognized atom
[19:46:43] [SPG] Initializing protein design engine
[19:46:43] [SPG] seed = 0
[19:46:43] [SPG] Initialization complete
[19:46:43] [SPG] Writing current.pdb, chainlength = 68
[19:46:43] [SPG] Writing current.xyz
[19:46:43] [SPG] Preprocessing . . .
[19:46:43] [SPG] 68 positions in protein
[19:47:29] [SPG] Preprocessing complete
[19:47:29] Iterations: 0 of 600
[19:47:30] Finished
[19:47:30] [SPG] Native chi angles stored
[19:47:31] [SPG] Rotamers read
[19:47:31] [SPG] Unrecognized atom
[19:47:31] [SPG] Unrecognized atom
[19:47:31] [SPG] Starting genetic algorithm
[19:48:45] [SPG] seed: 2324246
[19:48:46] [SPG] Designing protein sequence 1 of 30
[19:51:44] [SPG] 10.0
[19:54:39] [SPG] 20.0
[19:57:13] [SPG] 30.0
[19:59:39] [SPG] 40.0
[20:02:00] [SPG] 50.0
[20:04:14] [SPG] 60.0
[20:06:29] [SPG] 70.0
[20:08:48] [SPG] 80.0
[20:11:05] [SPG] 90.0
[20:13:19] [SPG] 100.0
[20:13:19] [SPG] Writing current.xyz
[20:13:20] [SPG] Sequence 1 completed:
[20:13:20] ELYSVYPISAPTSNMLPVTSGKLIKLINPSMGPVPLFYLRSDGKPGYGYG . . .
[20:13:20] Iterations: 20 of 600
[20:13:21] Finished
[20:13:22] [SPG] seed: 4648492
[20:13:22] [SPG] Designing protein sequence 2 of 30
[20:16:26] [SPG] 10.0
[20:19:21] [SPG] 20.0
[20:22:02] [SPG] 30.0
[20:24:17] [SPG] 40.0
[20:26:26] [SPG] 50.0
[20:28:30] [SPG] 60.0
[20:30:30] [SPG] 70.0
[20:32:27] [SPG] 80.0
[20:34:23] [SPG] 90.0
[20:36:22] [SPG] 100.0
[20:36:22] [SPG] Writing current.xyz
[20:36:22] [SPG] Sequence 2 completed:
[20:36:22] SLYAVYPFPASTSAAVNATAGQLLKPLNPTMGTVLVMYVPTPGTEGYMKG . . .
[20:36:22] Iterations: 40 of 600
[20:36:23] Finished
[20:36:24] [SPG] seed: 6972738
[20:36:24] [SPG] Designing protein sequence 3 of 30
[20:39:19] [SPG] 10.0
[20:42:06] [SPG] 20.0
[20:44:43] [SPG] 30.0
[20:47:08] [SPG] 40.0
[20:49:31] [SPG] 50.0
[20:52:02] [SPG] 60.0
[20:54:23] [SPG] 70.0
[20:56:40] [SPG] 80.0
[20:59:07] [SPG] 90.0
 
SPG has been around for a while but only for Windows folders. My progress monitor recognises SPG WUs as well as the other two although I'm not sure how well it handles it since I didn't have it running.
 
Originally posted by bousozoku
SPG has been around for a while but only for Windows folders. My progress monitor recognises SPG WUs as well as the other two although I'm not sure how well it handles it since I didn't have it running.

Which progress monitor is that?
 
Register on MacRumors! This sidebar will go away, and you'll see fewer ads.